PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g37360.1.p
Common NameBRADI_3g37360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 189aa    MW: 20237.5 Da    PI: 4.608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g37360.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49e-151055348
                      SS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +WT+eEde l ++v+  Gg  tW++Iar ++ gR +k+c++rw ++l
  Bradi3g37360.1.p 10 AWTEEEDEALRRGVRDGGGArTWDAIARGVP-GRDPKSCRLRWCQHL 55
                      8****************9889**********.***********9986 PP

2Myb_DNA-binding40.94.8e-1365106346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T++Ed  +++  +++G++ W+tIa ++g gR+++ +k+rw++
  Bradi3g37360.1.p  65 PFTAQEDAEIIRRQREFGNK-WATIALHLG-GRSDNAIKNRWNS 106
                       79******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.988359IPR017930Myb domain
SMARTSM007176.2E-12757IPR001005SANT/Myb domain
SuperFamilySSF466892.11E-247104IPR009057Homeodomain-like
PfamPF002494.7E-13955IPR001005SANT/Myb domain
CDDcd001675.79E-121055No hitNo description
Gene3DG3DSA:1.10.10.606.4E-181069IPR009057Homeodomain-like
SMARTSM007172.6E-1262110IPR001005SANT/Myb domain
PROSITE profilePS5129417.42362112IPR017930Myb domain
CDDcd001672.07E-1065105No hitNo description
PfamPF002491.2E-1165106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-1770112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSADGGKKAA WTEEEDEALR RGVRDGGGAR TWDAIARGVP GRDPKSCRLR WCQHLAPQLL  60
DAGRPFTAQE DAEIIRRQRE FGNKWATIAL HLGGRSDNAI KNRWNSALRK QLPMVAGADD  120
GHHHDDDAEE VAAEDDVPVC LELFPLTAGS LKEEAAAAAG EGDVVTDLTL GLPGGEAEEA  180
VVDLALRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A1e-2381422131MYB3
3zqc_D1e-2381422131MYB3
3zqc_G1e-2381422131MYB3
3zqc_J1e-2381422131MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236715.14e-92PREDICTED: transcription factor MYB44-like
TrEMBLI1I7J91e-132I1I7J9_BRADI; Uncharacterized protein
STRINGBRADI3G37360.11e-132(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-34myb domain protein 77